PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G050500.1.p
Common NameSb08g004250, SORBIDRAFT_08g004250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 405aa    MW: 45590.8 Da    PI: 6.2396
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G050500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.5e-1999145148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           +g WT+eEd +lv++v+q+G + W+ Ia+ ++ gR +kqc++rw+++l
  Sobic.008G050500.1.p  99 KGQWTPEEDRKLVKLVEQFGLRKWSYIAQLLP-GRVGKQCRERWHNHL 145
                           799*****************************.*************97 PP

2Myb_DNA-binding50.16.4e-16153193345
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            W  eEd  l++a+k+ G++ W+ Ia++++ gRt++++k++w+
  Sobic.008G050500.1.p 153 IWNDEEDMVLIQAHKEVGNK-WAEIAKRLP-GRTENSIKNHWN 193
                           5*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.37794149IPR017930Myb domain
SuperFamilySSF466894.31E-3196192IPR009057Homeodomain-like
SMARTSM007174.6E-1598147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-29100152IPR009057Homeodomain-like
CDDcd001678.45E-15102145No hitNo description
PfamPF139212.9E-18102159No hitNo description
PROSITE profilePS5129418.903150200IPR017930Myb domain
SMARTSM007179.5E-16150198IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-21153198IPR009057Homeodomain-like
CDDcd001671.64E-12154196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
QNGRCELHPV DHHPIEVIGD AAFNDLRHQF FTEREIKKPI FDRGSSIGHR VGSQLPLLTP  60
KTEVSHLMDS GLGSYKAYEM NGRFLPRKKT SLKKTNVVKG QWTPEEDRKL VKLVEQFGLR  120
KWSYIAQLLP GRVGKQCRER WHNHLRPNIK KDIWNDEEDM VLIQAHKEVG NKWAEIAKRL  180
PGRTENSIKN HWNATKRRQF ARRRSRNSSK GPKSGTLLQN YIKGLGICPS NKTVAVAVAA  240
TPLPEPKSSP SSSPETPGAK KPAKTDEIKL ENILNSQDIL LPSMEEYICS ESLSCDDLLA  300
PICDGFSVEM CDGLFDANEG GFQVCTVDDD DIDMNYIFNH IDHAIKVDPE IDMEMMMMMW  360
DEDALECAEP AGPAAHVETV HVKEEMDLIE MVAATQNCGE AENH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-44972002105MYB PROTO-ONCOGENE PROTEIN
1mse_C8e-44972002105C-Myb DNA-Binding Domain
1msf_C8e-44972002105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432523e-71AC243252.2 Panicum virgatum clone PV_ABa094-H10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441884.10.0hypothetical protein SORBIDRAFT_08g004250
TrEMBLC5YSM10.0C5YSM1_SORBI; Putative uncharacterized protein Sb08g004250
STRINGSb08g004250.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-59myb domain protein 98